Recombinant Human SLC29A4 protein (ab166000)

Overview

  • Product name
    Recombinant Human SLC29A4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRV QRSWPTFRALLLH
    • Amino acids
      283 to 345
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain transport protein PMAT
    • ENT 4
    • ENT4
    • Equilibrative nucleoside transporter 4
    • FLJ34923
    • Plasma membrane monoamine transporter
    • PMAT
    • Solute carrier family 29 (nucleoside transporters) member 4
    • Solute carrier family 29 member 4
    see all
  • Relevance
    SLC29A4 (Solute carrier family 29 (nucleoside transporters), member 4) is involved in the re-uptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It transports serotonin, dopamine and the neurotoxin 1-methyl-4-phenylpyridinium. It may also contribute to the regulation of extracellular adenosine concentrations.
  • Cellular localization
    Cell Membrane; Multi-pass membrane protein

Images

  • ab166000 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up