Recombinant Human SLC30A5 protein (ab163901)

Overview

  • Product name
    Recombinant Human SLC30A5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFES YDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPG RKEFKDKKLNDPRKLVGN
    • Amino acids
      1 to 118
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686F23142
    • FLJ12496
    • FLJ12756
    • hZTL1
    • MGC5499
    • Putative uncharacterized protein DKFZp686F23142
    • Slc30a5
    • Solute carrier family 30 (zinc transporter) member 5
    • Solute carrier family 30 (Zinc transporter), member 5 isoform CRA a
    • Solute carrier family 30 member 5
    • Zinc transporter 5
    • Zinc transporter ZnT 5
    • Zinc transporter ZTL1
    • ZNT 5
    • ZnT-5
    • ZnT-like transporter 1
    • ZNT5
    • ZNT5_HUMAN
    • ZNTL 1
    • ZNTL1
    • ZTL 1
    • ZTL1
    see all
  • Function
    Functions as a zinc transporter. May be a transporter of zinc into beta cells in order to form insulin crystals. Partly regulates cellular zinc homeostasis. Required with ZNT7 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT6 and ZNT7 for the activation of TNAP.
  • Tissue specificity
    Ubiquitously expressed. Highly expressed in pancreas, liver and kidney. Expressed abundantly in insulin-containing beta cells, undetectable in other endocrine cell types including glucagon-secreting alpha cells and most acinar cells.
  • Sequence similarities
    Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Perimeter of granules, localizes to the brush border membrane of the enterocyte. Concentrated in early compartments of the secretory pathway such as COPII-coated vesicles.
  • Information by UniProt

Images

  • ab163901 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up