Recombinant Human SLC30A9 protein (ab161006)

Overview

  • Product name
    Recombinant Human SLC30A9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNV VPCSHPYIGTLSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGAELK APLKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQL RKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEIE YRERLFRNQKILREYRDFLGNTKPRSRTASVFFKGPGKVVMVAICINGLN CFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHPY GFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILA GSLVSEGATLLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAA VLGVIIAATCMGLTSITGNPLYDSLGSLGVGTLLGMVSAFLIYTNTEALL GRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRFKAEVDFDGRV VTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLE KELKKRNPEVRHVDLEIL
    • Amino acids
      1 to 568
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C4orf1
    • Embryonic lung protein
    • Expressed in human embryonic lung
    • GAC63
    • HUEL
    • Human embryonic lung protein
    • Hypothetical protein SLC30A9
    • SLC30A9
    • Solute carrier family 30 (zinc transporter) member 9
    • Solute carrier family 30 member 9
    • Zinc transporter 9
    • ZnT-9
    • ZNT9
    • ZNT9_HUMAN
    see all
  • Function
    Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors (By similarity). Plays a role in transcriptional activation of Wnt-responsive genes.
  • Tissue specificity
    Ubiquitously expressed in fetal and adult tissues and cancer cell lines.
  • Sequence similarities
    Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.
  • Cellular localization
    Membrane. Nucleus.
  • Information by UniProt

Images

  • ab161006 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up