Recombinant Human SLC34A1 protein (ab159534)

Overview

  • Product name
    Recombinant Human SLC34A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFP SLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAM LLKVPLMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAILSNPVAGL VVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNT IVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRL VVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHS LIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPDLAV GLILLAGALVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWV TGYFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIG TTTTAILAALASPREKLSSAFQIALCHFFFNISGILLWYPVPCTRLPIRM AKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQVMVGVGTPFGA LLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCC ARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
    • Amino acids
      1 to 639
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FRTS2
    • Na(+)-dependent phosphate cotransporter 2A
    • Na(+)/Pi cotransporter 2A
    • Na+-phosphate cotransporter type II
    • naPi-2a
    • NAPI-3
    • naPi2a
    • NAPI3
    • NPHLOP1
    • NPT2
    • NPTIIa
    • renal sodium-dependent phosphate transporter
    • renal sodium/phosphate transporter protein 2
    • SLC11
    • SLC17A2
    • SLC17A2, formerly
    • sodium-dependent phosphate transport protein 2A
    • sodium-phosphate transport protein 2A
    • sodium/phosphate co-transporter
    • sodium/phosphate cotransporter 2A
    • sodium/phosphate transporter 2, kidney
    • solute carrier family 17 (sodium phosphate), member 2
    • solute carrier family 17, member 2, formerly
    • solute carrier family 34 (sodium phosphate), member 1
    • solute carrier family 34 (type II sodium/phosphate contransporter), member 1
    • solute carrier family 34 member 1
    see all
  • Relevance
    May be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane. Probably mediates 70-80% of the apical influx.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab159534 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up