Recombinant Human SLC35A1 protein (ab161044)

Overview

  • Product name
    Recombinant Human SLC35A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCI TEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV QNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFM LCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLK SSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVI FLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFA LGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
    • Amino acids
      1 to 337
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CMP-SA-Tr
    • CMP-Sia-Tr
    • CMP-sialic acid transporter
    • S35A1_HUMAN
    • Slc35a1
    • Solute carrier family 35 member A1
    see all
  • Function
    Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.
  • Involvement in disease
    Defects in SLC35A1 are the cause of congenital disorder of glycosylation type 2F (CDG2F) [MIM:603585]. CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
  • Sequence similarities
    Belongs to the nucleotide-sugar transporter family. SLC35A subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161044 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up