Recombinant Human SLC37A4 protein (ab132873)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLG FITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTV PVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGG LGPILATILAQSYSWRSTLALSGALCVVVSFLCLLLIHNEPADVGLRNLD PMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVKTCCTDWGQFF LIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFG VIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVA EVICAASTAAFFLLRNIRTKMGRVSKKAE
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 429

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G6PT1
    • G6PT1_HUMAN
    • G6PT2
    • G6PT3
    • Glucose-5-phosphate transporter
    • Glucose-6-phosphatase, transport (glucose) protein 3
    • Glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1
    • Glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2;
    • Glucose-6-phosphate translocase
    • Glucose-6-phosphate transporter 1
    • GSD1b
    • GSD1c
    • GSD1d
    • MGC15729
    • Microsomal glucose-6-phosphate transporter
    • PRO0685
    • SLC37A4
    • Solute carrier family 37 (glucose-6-phosphate transporter), member 4
    • Solute carrier family 37 member 4
    • Transformation-related gene 19 protein
    • TRG-19
    • TRG19
    see all
  • Function
    Transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. Forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
  • Tissue specificity
    Mostly expressed in liver and kidney.
  • Involvement in disease
    Defects in SLC37A4 are the cause of glycogen storage disease type 1B (GSD1B) [MIM:232220]. GSD1B is a metabolic disorder characterized by impairment of terminal steps of glycogenolysis and gluconeogenesis. GSD1 patients manifest a wide range of clinical symptoms and biochemical abnormalities, including hypoglycemia, severe hepatomegaly due to excessive accumulation of glycogen, kidney enlargement, growth retardation, lactic acidemia, hyperlipidemia, and hyperuricemia. GSD1B patients also present a tendency towards infections associated with neutropenia, relapsing aphthous gingivostomatitis, and inflammatory bowel disease.
    Defects in SLC37A4 are the cause of glycogen storage disease type 1C (GSD1C) [MIM:232240].
    Defects in SLC37A4 are the cause of glycogen storage disease type 1D (GSD1D) [MIM:232240].
  • Sequence similarities
    Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132873 stained with Coomassie Blue.

References

ab132873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up