Recombinant Human SLC38A2 protein (ab153369)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSWKELLTLYLRPAREYQELFLQTFFFFFVWEKILWQPGRNGKKILFST AN
    • Amino acids
      1 to 52
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amino acid transporter 2
    • Amino acid transporter A2
    • ATA2
    • KIAA1382
    • PRO1068
    • Protein 40-9-1
    • S38A2_HUMAN
    • SAT2
    • Slc38a2
    • SNAT2
    • Sodium-coupled neutral amino acid transporter 2
    • Solute carrier family 38 member 2
    • System A amino acid transporter
    • System A amino acid transporter 2
    • System A transporter 1
    • System N amino acid transporter 2
    see all
  • Function
    Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta.
  • Tissue specificity
    Ubiquitously expressed. Widely expressed in the central nervous system with higher concentrations in caudal regions. Expressed by glutamatergic and GABAergic neurons together with astrocytes and other non-neuronal cells in the cerebral cortex (at protein level).
  • Sequence similarities
    Belongs to the amino acid/polyamine transporter 2 family.
  • Post-translational
    modifications
    Polyubiquitination by NEDD4L regulates the degradation and the activity of SLC38A2.
  • Cellular localization
    Cell membrane. Insulin promotes recruitment to the plasma membrane from a pool localized in the trans-Golgi network or endosomes (By similarity). Enriched in the somatodendritic compartment of neurons, it is also detected at the axonal shaft but excluded from the nerve terminal.
  • Information by UniProt

Images

  • ab153369 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up