Recombinant Human SLC38A3 protein (ab161227)

Overview

  • Product name
    Recombinant Human SLC38A3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQ KSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFL FLLTAVALLSSYSIHLLLKSSGVVGIRAYEQLGYRAFGTPGKLAAALAIT LQNIGAMSSYLYIIKSELPLVIQTFLNLEEKTSDWYMNGNYLVILVSVTI ILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPCPLPPNFNNTT GNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQTAYTIPIMAFAFVCH PEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVES ELLHTYSKVDPFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFPNQ EFSWLRHVLIAVGLLTCINLLVIFAPNILGIFGVIGATSAPFLIFIFPAI FYFRIMPTEKEPARSTPKILALCSAMLGFLLMTMSLSFIIIDWASGTSRH GGNH
    • Amino acids
      1 to 504
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G17
    • N system amino acid transporter 1
    • N-system amino acid transporter 1
    • Na(+)-coupled neutral amino acid transporter 3
    • NAT1
    • SN1
    • SNAT3
    • Sodium coupled neutral amino acid transporter 3
    • Sodium-coupled neutral amino acid transporter 3
    • Solute carrier family 38 member 3
    • System N amino acid transporter 1
    • System N1 Na+ and H+ coupled glutamine transporter
    see all
  • Relevance
    SLC38A3 is a sodium dependent amino acid/proton antiporter. It mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. SLC38A3 may mediate amino acid transport in either direction under physiological conditions an may play a role in nitrogen metabolism and synaptic transmission.
  • Cellular localization
    Cell membrane; Multipass membrane protein

Images

  • ab161227 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up