Recombinant Human SLC39A5 protein (ab166129)

Overview

  • Product name
    Recombinant Human SLC39A5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQ GLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLE ESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLS PAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVL LLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQE GRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRK RRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQ GHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVF CHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPV PLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGG LMLAITLLEERLLPVTTEG
    • Amino acids
      21 to 539
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LZT Hs7
    • MGC34778
    • OTTHUMP00000211153
    • OTTHUMP00000211154
    • S39A5_HUMAN
    • SLC39A5
    • solute carrier family 39 (metal ion transporter), member 5
    • Solute carrier family 39 member 5
    • Zinc transporter ZIP5
    • Zinc transporter ZIP5 [Precursor]
    • ZIP 5
    • ZIP-5
    • ZIP5
    • Zrt and Irt like protein 5
    • Zrt- and Irt-like protein 5
    see all
  • Function
    May play a role in polarized cells by carrying out serosal-to-mucosal zinc transport. Plays a role in eye development. Could regulate the BMP/TGF-beta (bone morphogenetic protein/transforming growth factor-beta) signaling pathway and modulates extracellular matrix (ECM) proteins of the sclera (PubMed:24891338). Seems to play a central role in controlling organismal zinc status.
  • Tissue specificity
    Expressed in liver, kidney, pancreas, small intestine, colon, spleen, fetal liver and fetal kidney.
  • Involvement in disease
    Myopia 24, autosomal dominant
  • Sequence similarities
    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Basolateral cell membrane.
  • Information by UniProt

Images

  • ab166129 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up