Recombinant Human SLC39A7 protein (ab159915)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHS HEDFHHGHSHAHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHES LYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPF FVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHT LEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGH GHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALL TEGGAVGSEIAGGAGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLL EVLGLLGGVIMMVLIAHLE
    • Amino acids
      1 to 469
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D6S115E
    • D6S2244E
    • H2 KE4
    • Histidine rich membrane protein Ke4
    • Histidine-rich membrane protein Ke4
    • HKE4
    • HLA class II region expressed gene KE4
    • KE4
    • Ke4 gene mouse, human homolog of
    • Really interesting new gene 5 protein
    • RING5
    • S39A7_HUMAN
    • SLC39A7
    • Solute carrier family 39 (zinc transporter), member 7
    • Solute carrier family 39 member 7
    • solute carrier family 39 zinc transporter member 7
    • Zinc transporter SLC39A7
    • ZIP7
    see all
  • Tissue specificity
    Major expression in placenta, lung, kidney and pancreas.
  • Sequence similarities
    Belongs to the ZIP transporter (TC 2.A.5) family. KE4/Catsup subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159915 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up