Recombinant Human SLC40A1 protein (ab153316)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFL VELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN VSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIANIANLASTAT AITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGS PVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLN LHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV SYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASA ITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDL SVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESV PIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMN YLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFRFAQNTLGNKL FACGPDAKEVRKENQANTSVV
    • Amino acids
      1 to 571
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ferroportin
    • Ferroportin 1
    • Ferroportin-1
    • FPN1
    • HFE4
    • IREG1
    • iron regulated gene 1
    • Iron regulated transporter 1
    • Iron-regulated transporter 1
    • MST079
    • MSTP079
    • MTP1
    • putative ferroportin 1 variant IIIA
    • putative ferroportin 1 variant IIIB
    • S40A1_HUMAN
    • SLC11A3
    • SLC11A3, formerly
    • SLC40A1
    • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3
    • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, formerly
    • solute carrier family 40 (iron-regulated transporter), member 1
    • Solute carrier family 40 member 1
    see all
  • Function
    May be involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. Mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin).
  • Tissue specificity
    Expressed in placenta, intestine, muscle and spleen.
  • Involvement in disease
    Defects in SLC40A1 are the cause of hemochromatosis type 4 (HFE4) [MIM:606069]. HFE4 is an autosomal dominant iron-loading disorder characterized by early iron accumulation in reticuloendothelial cells and a marked increase in serum ferritin before elevation of the transferrin saturation.
  • Sequence similarities
    Belongs to the SLC40A transporter family.
  • Cellular localization
    Cell membrane. Localized to the basolateral membrane of polarized epithelial cells.
  • Information by UniProt

Images

  • ab153316 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up