Recombinant Human SLC43A2 protein (ab165227)

Overview

  • Product name
    Recombinant Human SLC43A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPTLATAHRRRWWMACTAVLENLLFSAVLLGWGSLLIMLKSEGFYSYLC TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS AITLPLGIVMDKYGPRKLRLLGSACFAVSCLLIAYGASKPNALSVLIFIA LALNGFGGMCMTFTSLTLPNMFGDLRSTFIALMIGSYASSAVTFPGIKLI YDAGVSFIVVLVVWAGCSGLVFLNCFFNWPLEPFPGPEDMDYSVKIKFSW LGFDHKITGKQFYKQVTTVGRRLSVGSSMRSAKEQVALQEGHKLCLSTVD LEVKCQPDAAVAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILK FLVSGDQKTVGLYTSIFGVLQLLCLLTAPVIGYIMDWRLKECEDASEEPE EKDANQGEKKKKKRDRQIQKITNAMRAFAFTNLLLVGFGVTCLIPNLPLQ ILSFILHTIVRGFIHSAVGGLYAAVYPSTQFGSLTGLQSLISALFALLQQ PLFLAMMGPLQGDPLWVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQ EDDKLFLKINGSSNQEAFV
    • Amino acids
      1 to 569
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ23848
    • L-type amino acid transporter 4
    • Large neutral amino acids transporter small subunit 4
    • LAT4
    • LAT4_HUMAN
    • MGC34680
    • SLC43A2
    • Solute carrier family 43 (amino acid system L transporter) member 2
    • Solute carrier family 43 member 2
    see all
  • Function
    Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.
  • Tissue specificity
    Detected in several tissues with, higher expression in placenta, kidney and peripheral blood leukocytes. In the kidney is detected in epithelial cells of the distal tubule and collecting duct. In the intestine is expressed mainly in crypt cells of the intestinal microvilli ans epithelial cells in the base of the villus.
  • Sequence similarities
    Belongs to the SLC43A transporter (TC 2.A.1.44) family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165227 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up