Recombinant Human SLC44A2 protein (ab163506)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAV GIIAWTHGDPRKVIYPTDSRGEFCGQKGTKNENKPYLFYFNIVKCASPLV LLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCVPGFKNNKGVA EVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKN ITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLVIAMAMSLLFI ILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEA SRAVGYVMCSLLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSP CPFTAKTCNPETFPSSNESRQCPNARCQFAFYGGESGYHRALLGLQIFNA FMFFWLANFVLALGQVTLAGAFASYYWALRKPDDLPAFPLFSAFGRALRY HTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCLMTCLKCCFWC LEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSY LIAHGFFSVYGMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKPLNKTN KKAAES
    • Amino acids
      1 to 706
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Choline transporter like protein 2
    • Choline transporter-like protein 2
    • CTL 2
    • CTL2
    • CTL2_HUMAN
    • DKFZp666A071
    • FLJ44586
    • PP1292
    • SLC44A2
    • Solute carrier family 44 (choline transporter) member 2
    • Solute carrier family 44 member 2
    • Testicular tissue protein Li 47
    see all
  • Function
    Putative choline transporter.
  • Tissue specificity
    Present in supporting cells of the inner ear (at protein level).
  • Sequence similarities
    Belongs to the CTL (choline transporter-like) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163506 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up