Recombinant Human SLC45A2 protein (ab162435)

Overview

  • Product name
    Recombinant Human SLC45A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYA VEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWG RRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVV LFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAES TGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL
    • Amino acids
      1 to 243
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1A1
    • AIM 1
    • AIM1
    • MATP
    • Melanoma antigen AIM1
    • Membrane associated transporter
    • Membrane associated transporter protein
    • Membrane-associated transporter protein
    • Protein AIM 1
    • Protein AIM-1
    • Protein AIM1
    • S45A2_HUMAN
    • SHEP5
    • SLC45A2
    • Solute carrier family 45 member 2
    • Underwhite
    see all
  • Function
    Melanocyte differentiation antigen. May transport substances required for melanin biosynthesis.
  • Tissue specificity
    Expressed in most melanoma cell lines and melanocytes.
  • Involvement in disease
    Albinism, oculocutaneous, 4
  • Sequence similarities
    Belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family.
  • Cellular localization
    Melanosome membrane.
  • Information by UniProt

Images

  • ab162435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up