Recombinant Human SLC6A16 protein (ab162188)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKS MVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP
    • Amino acids
      406 to 492
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NT5
    • NTT5
    • Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
    • S6A16_HUMAN
    • SLC6A16
    • solute carrier family 6 (neurotransmitter transporter), member 16
    • Solute carrier family 6 member 16
    see all
  • Tissue specificity
    Highly expressed in peripheral tissues, particularly in testis, pancreas, and prostate.
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A16 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162188 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up