Recombinant Human SLC6A20 protein (ab162821)

Overview

  • Product name
    Recombinant Human SLC6A20 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSE MFPQIKNCSLESELDTAVQ
    • Amino acids
      301 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC161475
    • Neurotransmitter transporter RB21A
    • Neurotransmitter transporter rB21A homolog
    • Orphan transporter XT3
    • S6A20_HUMAN
    • SIT 1
    • SIT1
    • SLC6A20
    • Sodium and chloride dependent transporter XTRP3
    • Sodium- and chloride-dependent transporter XTRP3
    • Sodium/imino acid transporter 1
    • Sodium/imino-acid transporter 1
    • Solute carrier family 6 (neurotransmitter transporter) member 20
    • Solute carrier family 6 (proline IMINO transporter) member 20
    • Solute carrier family 6 member 20
    • Transporter rB21A homolog
    • X transporter protein 3
    • XT 3
    • XT3
    • Xtrp 3
    • Xtrp3
    see all
  • Function
    Mediates the calcium-dependent uptake of imino acids such as L-proline, N-methyl-L-proline and pipecolate as well as N-methylated amino acids. Involved in the transport of glycine.
  • Tissue specificity
    Kidney and small intestine. Expressed in the S3 segment of the proximal tubule.
  • Involvement in disease
    Defects in SLC6A20 are a cause of hyperglycinuria (HG) [MIM:138500]. It is a condition characterized by excess of glycine in the urine. In some cases it is associated with renal colic and renal oxalate stones.
    Defects in SLC6A20 are a cause of iminoglycinuria (IG) [MIM:242600]. It is a disorder of renal tubular reabsorption of glycine and imino acids (proline and hydroxyproline), marked by excessive levels of all three substances in the urine. Note=Haploinsufficiency of SLC6A20 combined with deficiency of the neutral amino acid transporter SLC6A19 or partially inactivating mutations in SLC36A2, is responsible for iminoglycinuria. Additional polymorphisms and mutations in SLC6A18 can contribute to the IG phenotype in some families.
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A20 subfamily.
  • Cellular localization
    Apical cell membrane. Located in the apical brush border membrane of kidney proximal tubule cells.
  • Information by UniProt

Images

  • ab162821 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up