Recombinant Human SLC6A7 protein (ab159523)

Overview

  • Product name
    Recombinant Human SLC6A7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKKLQGAHLRKPVTPDLLMTPSDQGDVDLDVDFAAHRGNWTGKLDFLLSC IGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQF SSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTS DLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLH IQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFP YLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQ ELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQ FAFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLILTTDGGMYWL VLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRA CWLFLSPATLLALLVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMI PAGMLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQS PKPLMVHMRKYGGITSFENTAIEVDREIAEEEESMM
    • Amino acids
      1 to 636
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • solute carrier family 6 (neurotransmitter transporter, L-proline), member 7
    • brain-specific L-proline transporter
    • L-proline transporter, brain-specific
    • PROT
    • SC6A7_HUMAN
    • Slc6a7
    • Sodium-dependent proline transporter
    • solute carrier family 6 (neurotransmitter transporter), member 7
    • Solute carrier family 6 member 7
    see all
  • Function
    Terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A7 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159523 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up