Recombinant Human SLC9A6 protein (ab161012)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPM DDSEPPLNLLDNTRHGPA
    • Amino acids
      602 to 669
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3732426M05
    • 6430520C02Rik
    • KIAA0267
    • mKIAA0267
    • MRSA
    • Na(+)/H(+) exchanger 6
    • NHE-6
    • NHE6
    • OTTHUMP00000024089
    • OTTHUMP00000024090
    • RGD1563582
    • RP11-274K13.1
    • RP23-105E2.4
    • SL9A6_HUMAN
    • SLC9A6
    • Sodium/hydrogen exchanger 6
    • Solute carrier family 9 (sodium/hydrogen exchanger), isoform 6
    • Solute carrier family 9 (sodium/hydrogen exchanger), member 6
    • Solute carrier family 9 member 6
    • solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6
    see all
  • Function
    Electroneutral exchange of protons for Na(+) and K(+) across the early and recycling endosome membranes. Contributes to calcium homeostasis.
  • Tissue specificity
    Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.
  • Involvement in disease
    Defects in SLC9A6 are the cause of mental retardation syndromic X-linked Christianson type (MRXSC) [MIM:300243]; also known as MRXS-Christianson or X-linked Angelman-like syndrome. The phenotype is characterized by profound mental retardation, epilepsy, ataxia, and microcephaly, and showed phenotypic overlap with Angelman syndrome.
  • Sequence similarities
    Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Cellular localization
    Endosome membrane. Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane.
  • Information by UniProt

Images

  • ab161012 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up