Recombinant Human SLC9A9 protein (ab153640)

Overview

  • Product name
    Recombinant Human SLC9A9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQG NAILEK
    • Amino acids
      71 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730527A11Rik
    • 9930105B05
    • AI854429
    • FLJ35613
    • Na(+)/H(+) exchanger 9
    • Nbla00118
    • NHE 9
    • NHE-9
    • NHE9
    • Putative protein product of Nbla00118
    • SL9A9_HUMAN
    • Slc9a9
    • Sodium/hydrogen exchanger 9
    • Sodium/proton exchanger NHE9
    • Solute carrier family 9 (sodium/hydrogen exchanger) isoform 9
    • Solute carrier family 9 (sodium/hydrogen exchanger) member 9
    • Solute carrier family 9 member 9
    see all
  • Function
    May act in electroneutral exchange of protons for Na(+) across membranes. Involved in the effusion of Golgi luminal H(+) in exchange for cytosolic cations. Involved in organelle ion homeostasis by contributing to the maintainance of the unique acidic pH values of the Golgi and post-Golgi compartments in the cell.
  • Tissue specificity
    Ubiquitously expressed in all tissues tested. Expressed at highest levels in heart and skeletal muscle, followed by placenta, kidney, and liver. Expressed in the brain, in the medulla and spinal cord.
  • Involvement in disease
    Note=A chromosomal aberration involving SLC9A9 has been found in a family with early-onset behavioral/developmental disorder with features of attention deficit-hyperactivity disorder and intellectual disability. Inversion inv(3)(p14:q21). The inversion disrupts DOCK3 and SLC9A9.
    Defects in SLC9A9 are a cause of susceptibility to autism type 16 (AUTS16) [MIM:613410]. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. AUTS16 can be associated with epilepsy.
  • Sequence similarities
    Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Cellular localization
    Late endosome membrane.
  • Information by UniProt

Images

  • ab153640 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up