Recombinant Human SLCO4C1 protein (ab166349)

Overview

  • Product name
    Recombinant Human SLCO4C1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQ KPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQR CNTPGGFLLHYCLLAVTQGIVVNGLVNISISTVEKRYEMKSSLTGLISSS YDISFCLLSLFVSFFGERGHKPRWLAFAAFMIGLGALVFSLPQFFSGEYK LGSLFEDTCVTTRNSTSCTSSTSSLSNYLYVFILGQLLLGAGGTPLYTLG TAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTIYIDVAMGES TDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKT SQAHQSNSNADVKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTG FATFLPKFIENQFGLTSSFAATLGGAVLIPGAALGQILGGFLVSKFRMTC KNTMKFALFTSGVALTLSFVFMYAKCENEPFAGVSESYNGTGELGNLIAP CNANCNCSRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPKVYYNCSCIER KTEITSTAETFGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITV SILRCVNHRQRSLALGIQFMVLRLLGTIPGPIIFGFTIDSTCILWDINDC GIKGACWIYDNIKMAHMLVAISVTCKVITMFFNGFAIFLYKPPPSATDVS FHKENAVVTNVLAEQDLNKIVKEG
    • Amino acids
      1 to 724
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9530051F04
    • C330017E21Rik
    • OATP-H
    • OATP-M1
    • Oatp4c1
    • OATPX
    • Organic anion transporter M1
    • PRO2176
    • Slc21A20
    • SLCO4C1
    • SO4C1_HUMAN
    • Solute carrier family 21 member 20
    • Solute carrier organic anion transporter family member 4C1
    see all
  • Function
    Organic anion transporter, capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. May participate in the regulation of membrane transport of ouabain. Involved in the uptake of the dipeptidyl peptidase-4 inhibitor sitagliptin and hence may play a role in its transport into and out of renal proximal tubule cells. May be involved in the first step of the transport pathway of digoxin and various compounds into the urine in the kidney. May be involved in sperm maturation by enabling directed movement of organic anions and compounds within or between cells. This ion-transporting process is important to maintain the strict epididymal homeostasis necessary for sperm maturation. May have a role in secretory functions since seminal vesicle epithelial cells are assumed to secrete proteins involved in decapacitation by modifying surface proteins to facilitate the acquisition of the ability to fertilize the egg.
  • Tissue specificity
    Predominantly expressed in kidney but also weakly expressed in both fetal liver and kidney.
  • Sequence similarities
    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Cellular localization
    Basolateral cell membrane. Detected at the basolateral membrane of the proximal tubule cell in the kidney.
  • Information by UniProt

Images

  • ab166349 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up