Recombinant Human Slingshot homolog 1 protein (ab153370)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAAL FLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESA WADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTK IHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPG GVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGER TERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEML LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFP GLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRS ASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDAS KQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESQLPFLDDAAQ PGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEV HRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGR WGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCA DCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRV PEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKV LPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKP TTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASR LEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPP FFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGL VKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPST VADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS
    • Amino acids
      1 to 1049
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW551225
    • Coro1c
    • coronin, actin binding protein 1C
    • Gm1394
    • Gm1395
    • hSSH-1L
    • mSSH 1L
    • OTTMUSP00000031415
    • Protein phosphatase Slingshot homolog 1
    • Slingshot 1
    • slingshot 1L
    • slingshot homolog 1
    • slingshot like 1
    • Slingshot1
    • SSH 1
    • SSH 1L
    • SSH-1L
    • SSH-like protein 1
    • Ssh1
    • SSH1_HUMAN
    see all
  • Function
    Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly. Inhibitory phosphorylation of cofilin is mediated by LIMK1, which may also be dephosphorylated and inactivated by this protein.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications
    Phosphorylated. Inhibitory phosphorylation by PAK4 promotes binding to YWHAZ. Phosphorylation at Ser-978 is decreased by stimuli which promote actin reorganization and lamellipodia formation. Can be dephosphorylated and activated by PPP3CA/calcineurin A. Phosphorylation decreases immediately prior to telophase.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cleavage furrow. Midbody. Also recruited to actin rich membrane protrusions such as lamellipodia, which may allow local control of actin dynamics at sites of cell locomotion. Also localized to the cleavage furrow and the midbody during cytokinesis.
  • Information by UniProt

Images

  • ab153370 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up