Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEE DLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRD
    • Amino acids
      1361 to 1460
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Drad 1
    • E030015M03Rik
    • E130320P19Rik
    • FLJ14420
    • OTTHUMP00000158695
    • OTTHUMP00000217852
    • OTTHUMP00000217853
    • OTTHUMP00000217854
    • Slil 3
    • Slil3
    • Slit 2
    • Slit homolog 2
    • Slit homolog 2 (Drosophila)
    • Slit homolog 2 protein
    • Slit homolog 2 protein C-product
    • Slit-2
    • Slit2
    • SLIT2_HUMAN
    see all
  • Function
    Thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tube and projection of axons to different regions. SLIT1 and SLIT2 seem to be essential for midline guidance in the forebrain by acting as repulsive signal preventing inappropriate midline crossing by axons projecting from the olfactory bulb. In spinal chord development may play a role in guiding commissural axons once they reached the floor plate by modulating the response to netrin. In vitro, silences the attractive effect of NTN1 but not its growth-stimulatory effect and silencing requires the formation of a ROBO1-DCC complex. May be implicated in spinal chord midline post-crossing axon repulsion. In vitro, only commissural axons that crossed the midline responded to SLIT2. In the developing visual system appears to function as repellent for retinal ganglion axons by providing a repulsion that directs these axons along their appropriate paths prior to, and after passage through, the optic chiasm. In vitro, collapses and repels retinal ganglion cell growth cones. Seems to play a role in branching and arborization of CNS sensory axons, and in neuronal cell migration. In vitro, Slit homolog 2 protein N-product, but not Slit homolog 2 protein C-product, repels olfactory bulb (OB) but not dorsal root ganglia (DRG) axons, induces OB growth cones collapse and induces branching of DRG axons. Seems to be involved in regulating leukocyte migration.
  • Tissue specificity
    Fetal lung and kidney, and adult spinal cord. Weak expression in adult adrenal gland, thyroid, trachea and other tissues examined.
  • Sequence similarities
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 7 EGF-like domains.
    Contains 1 laminin G-like domain.
    Contains 20 LRR (leucine-rich) repeats.
    Contains 4 LRRCT domains.
    Contains 4 LRRNT domains.
  • Domain
    The leucine-rich repeat domain is sufficient for guiding both axon projection and neuronal migration, in vitro.
  • Cellular localization
    Secreted. The C-terminal cleavage protein is more diffusible than the larger N-terminal protein that is more tightly cell associated.
  • Information by UniProt

Images

  • ab152971 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up