Recombinant Human Slit3 protein (ab116753)

Overview

  • Product nameRecombinant Human Slit3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75094
    • SpeciesHuman
    • SequencePCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHG QCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
    • Molecular weight37 kDa including tags
    • Amino acids1371 to 1470

Specifications

Our Abpromise guarantee covers the use of ab116753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ10764
    • KIAA0814
    • MEGF 5
    • MEGF5
    • Multiple EGF-like domains protein 5
    • Multiple epidermal growth factor like domains 5
    • Multiple epidermal growth factor-like domains protein 5
    • SLIL 2
    • SLIL2
    • SLIT 1
    • Slit 2
    • Slit 3
    • Slit homolog 3
    • Slit homolog 3 (Drosophila)
    • Slit homolog 3 protein
    • Slit-3
    • SLIT1
    • Slit2
    • Slit3
    • SLIT3_HUMAN
    see all
  • FunctionMay act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
  • Tissue specificityPredominantly expressed in thyroid.
  • Sequence similaritiesContains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 9 EGF-like domains.
    Contains 1 laminin G-like domain.
    Contains 20 LRR (leucine-rich) repeats.
    Contains 4 LRRCT domains.
    Contains 4 LRRNT domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Slit3 protein images

  • 12.5% SDS-PAGE analysis of ab116753 at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human Slit3 protein (ab116753)

ab116753 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry.

I am pleased to confirm that these are now available on the online datasheet. Please select the SDS tab near the top left hand side of the datasheet.

Slit3 protein ab116753
http://www.abcam.com/ind...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"