Recombinant Human Slit3 protein (ab116753)

Overview

  • Product name
    Recombinant Human Slit3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHG QCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1371 to 1470

Specifications

Our Abpromise guarantee covers the use of ab116753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ10764
    • KIAA0814
    • MEGF 5
    • MEGF5
    • Multiple EGF-like domains protein 5
    • Multiple epidermal growth factor like domains 5
    • Multiple epidermal growth factor-like domains protein 5
    • SLIL 2
    • SLIL2
    • SLIT 1
    • Slit 2
    • Slit 3
    • Slit homolog 3
    • Slit homolog 3 (Drosophila)
    • Slit homolog 3 protein
    • Slit-3
    • SLIT1
    • Slit2
    • Slit3
    • SLIT3_HUMAN
    see all
  • Function
    May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
  • Tissue specificity
    Predominantly expressed in thyroid.
  • Sequence similarities
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 9 EGF-like domains.
    Contains 1 laminin G-like domain.
    Contains 20 LRR (leucine-rich) repeats.
    Contains 4 LRRCT domains.
    Contains 4 LRRNT domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Slit3 protein images

  • 12.5% SDS-PAGE analysis of ab116753 at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human Slit3 protein (ab116753)

ab116753 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry.

I am pleased to confirm that these are now available on the online datasheet. Please select the SDS tab near the top left hand side of the datasheet.

Slit3 protein ab116753
http://www.abcam.com/ind...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up