Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQEL KEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFY PIPSLHSTGS
    • Amino acids
      1126 to 1235
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CTCL tumor antigen se20 9
    • LOSK
    • se20 9
    • Serine/threonine protein kinase 2
    • SLK
    • SNF1 sucrose nonfermenting like kinase
    • STE20 like serine/threonine-protein kinase
    • STE20 related kinase
    • STK2
    see all
  • Relevance
    SLK is a serine/threonine protein kinase that is involved in cytoskeletal reorganization and apoptosis. SLK is a microtubule-associated protein inducing actin stress fiber disassembly, it also mediates apoptosis and it is ubiquitously expressed; highest expression is found in heart and in skeletal muscle. There are two named isoforms.
  • Cellular localization
    Cytoplasmic

Images

  • ab153016 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up