Overview

  • Product name
    Recombinant Human SLMAP protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKA ENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLR EKGNNKPW
    • Amino acids
      677 to 784
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ42206
    • KIAA1601
    • MGC138760
    • MGC138761
    • Sarcolemma associated protein
    • Sarcolemmal associated protein
    • Sarcolemmal membrane associated protein
    • SLAP
    see all
  • Relevance
    Multiple SLMAP (Sarcolemmal-membrane-associated protein) mRNAs are generated by alternative splicing mechanisms. These isoforms have unique COOH-terminal membrane anchors that target SLMAP to distinct subcellular membranes. Regulated levels and the temporal induction of SLMAP isoforms are important for normal muscle development.
  • Cellular localization
    Cell membrane, sarcolemma; Single-pass type IV membrane protein. Note=Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule-dependent manner

Images

  • ab159904 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up