Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13094
    • SpeciesHuman
    • SequenceMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLT ENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEE DNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPS NDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPF DREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDS SKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSD IIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
    • Molecular weight85 kDa including tags
    • Amino acids1 to 533

Specifications

Our Abpromise guarantee covers the use of ab114697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 76 kDa tyrosine phosphoprotein
    • CG8697
    • LCP 2
    • LCP2
    • LCP2_HUMAN
    • Lymphocyte cytosolic protein 2
    • SH2 domain containing leukocyte protein 76 KD
    • SH2 domain containing leukocyte protein of 76kD
    • SH2 domain containing leukocyte protein of 76kDa
    • SH2 domain-containing leukocyte protein of 76 kDa
    • SLP 76
    • SLP 76 tyrosine phosphoprotein
    • SLP-76
    • SLP-76 tyrosine phosphoprotein
    • SLP76
    • SLP76 tyrosine phosphoprotein
    see all
  • FunctionInvolved in T-cell antigen receptor mediated signaling.
  • Tissue specificityHighly expressed in spleen, thymus and peripheral blood leukocytes. Highly expressed also in T-cell and monocytic cell lines, expressed at lower level in B-cell lines. Not detected in fibroblast or neuroblastoma cell lines.
  • Sequence similaritiesContains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH2 domain.
  • DomainThe SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications
    Phosphorylated after T-cell receptor activation by ZAP-70.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SLP76 protein images

  • 12.5% SDS-PAGE showing ab114697 at approximately 84.74 kDa stained with Coomassie Blue.

References for Recombinant Human SLP76 protein (ab114697)

ab114697 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"