Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP03973
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSD WQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNF CEMDGQCKRDLKCCMGMCGKSCVSPVKA
    • Molecular weight14 kDa
    • Amino acids26 to 132
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 80 % SDS-PAGE.
    ab99142 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • ALK 1
    • ALK1
    • ALP
    • Antileukoprotease
    • Antileukoproteinase
    • Antileukoproteinase 1
    • Antileukoproteinase1
    • BLPI
    • Human seminal protease inhibitor
    • HUSI
    • HUSI 1
    • HUSI I
    • HUSI-1
    • MPI
    • Mucus proteinase inhibitor
    • Protease inhibitor WAP4
    • Secretory leukocyte peptidase inhibitor
    • Secretory leukocyte protease inhibitor
    • Seminal proteinase inhibitor
    • SLPI
    • SLPI_HUMAN
    • WAP four disulfide core domain protein 4
    • WAP four-disulfide core domain protein 4
    • WAP4
    • WFDC4
    see all
  • FunctionAcid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.
  • Tissue specificityMucous fluids.
  • Sequence similaritiesContains 2 WAP domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human SLPI protein images

  • 15% SDS-PAGE analysis of 3µg ab99142.

References for Recombinant Human SLPI protein (ab99142)

ab99142 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"