Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKH KQLHCDAQSRKSFSCKYCDKEYV
    • Molecular weight
      34 kDa including tags
    • Amino acids
      97 to 169

Specifications

Our Abpromise guarantee covers the use of ab114212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC10182
    • Neural crest transcription factor Slug
    • Protein snail homolog 2
    • Slug (chicken homolog) zinc finger protein
    • Slug homolog zinc finger protein
    • Slug zinc finger protein
    • SLUGH
    • SLUGH 1
    • SLUGH1
    • SNAI 2
    • Snai2
    • SNAI2_HUMAN
    • Snail 2
    • Snail homolog 2
    • Snail2
    • WS 2D
    • WS2D
    • Zinc finger protein SLUG
    • Zinc finger protein SNAI2
    see all
  • Function
    Transcriptional repressor. Involved in the generation and migration of neural crest cells.
  • Tissue specificity
    Expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle.
  • Involvement in disease
    Defects in SNAI2 are the cause of Waardenburg syndrome type 2D (WS2D) [MIM:608890]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
  • Sequence similarities
    Belongs to the snail C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human SLUG protein images

  • 12.5% SDS-PAGE analysis of ab114212 stained with Coomassie Blue.

References for Recombinant Human SLUG protein (ab114212)

ab114212 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up