Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRK KGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPR LRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVP LAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPL CCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWL CQMDTEKEVEDSELEEAHWTDLLET
    • Amino acids
      1 to 275
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GIY YIG domain containing protein 1
    • GIY-YIG domain-containing protein 1
    • GIYD 1
    • GIYD 2
    • GIYD1
    • GIYD2
    • SLX 1
    • SLX1
    • SLX1 structure-specific endonuclease subunit homolog A (S. cerevisiae)
    • SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae)
    • SLX1_HUMAN
    • SLX1A
    • Slx1b
    • structure specific endonuclease subunit SLX1
    • Structure-specific endonuclease subunit SLX1
    see all
  • Function
    Catalytic subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for 5'-flap structures, and promotes symmetrical cleavage of static and migrating Holliday junctions (HJs). Resolves HJs by generating two pairs of ligatable, nicked duplex products.
  • Sequence similarities
    Belongs to the SLX1 family.
    Contains 1 GIY-YIG domain.
    Contains 1 SLX1-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163955 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up