Recombinant Human SM22 alpha protein (ab101469)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ01995
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERL VEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVP ENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTL MALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG SNRGASQAGMTGYGRPRQIIS
    • Molecular weight25 kDa including tags
    • Amino acids1 to 201
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab101469 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 22 kDa actin binding protein
    • 22 kDa actin-binding protein
    • Human 22kDa smooth muscle protein
    • Protein WS3-10
    • SM22
    • SM22 alpha
    • SM22-alpha
    • SMCC
    • Smooth muscle protein 22-alpha
    • TAGL_HUMAN
    • TAGLN
    • TAGLN1
    • Transgelin
    • Transgelin variant 2
    • WS3 10
    see all
  • FunctionActin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
  • Sequence similaritiesBelongs to the calponin family.
    Contains 1 calponin-like repeat.
    Contains 1 CH (calponin-homology) domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SM22 alpha protein images

  • 15% SDS-PAGE analysis of 3µg ab101469.

References for Recombinant Human SM22 alpha protein (ab101469)

ab101469 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"