Recombinant Human SM22 alpha protein (ab101469)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERL VEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVP ENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTL MALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG SNRGASQAGMTGYGRPRQIIS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 201
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab101469 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 22 kDa actin binding protein
    • 22 kDa actin-binding protein
    • Human 22kDa smooth muscle protein
    • Protein WS3-10
    • SM22
    • SM22 alpha
    • SM22-alpha
    • SMCC
    • Smooth muscle protein 22-alpha
    • TAGL_HUMAN
    • TAGLN
    • TAGLN1
    • Transgelin
    • Transgelin variant 2
    • WS3 10
    see all
  • Function
    Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
  • Sequence similarities
    Belongs to the calponin family.
    Contains 1 calponin-like repeat.
    Contains 1 CH (calponin-homology) domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101469.

References

ab101469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up