Recombinant Human SMARCA6 protein (ab114875)

Overview

  • Product name
    Recombinant Human SMARCA6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVD RERAVVEVNIPVESEVNLKLQNIMMLLRKCCNHPYLIEYPIDPVTQEFKI DEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDF NFSRLDGSMSYSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVI IYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKR KLEKLIIHKNHFKGGQSGLNLSKNFLDPKELMELLKSRDYEREIKGSREK VISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF
    • Molecular weight
      64 kDa including tags
    • Amino acids
      1 to 348

Specifications

Our Abpromise guarantee covers the use of ab114875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10339
    • Helicase lymphoid specific
    • Hells
    • HELLS_HUMAN
    • LSH
    • Lymphoid specific helicase
    • Lymphoid-specific helicase
    • Nbla10143
    • PASG
    • Proliferation associated SNF2 like protein
    • Proliferation-associated SNF2-like protein
    • SWI/SNF2 related matrix associated actin dependent regulator of chromatin subfamily A member 6
    • SWI/SNF2-related matrix-associated actin-dependent regulator of chromatin subfamily A member 6
    see all
  • Function
    Plays an essential role in normal development and survival. Involved in regulation of the expansion or survival of lymphoid cells. Required for de novo or maintenance DNA methylation. May control silencing of the imprinted CDKN1C gene through DNA methylation. May play a role in formation and organization of heterochromatin, implying a functional role in the regulation of transcription and mitosis.
  • Tissue specificity
    Highly expressed in proliferative tissues such as adult thymus and testis, and expressed at lower levels in uterus, small intestine, colon, and peripheral blood mononuclear cells. Also expressed in neoplastic cell lines including those derived from myeloid and lymphoid leukemias.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus. Closely associated with pericentric heterochromatin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114875 at approximately 64.39kDa.
    Stained with Coomassie Blue.

References

ab114875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up