Recombinant Human SMARCAD1 protein (ab153429)

Overview

  • Product name
    Recombinant Human SMARCAD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVS RANTPDSDITEKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSED VVSPNCSNTVQEKTFNKDTVIIVSEPSEDEESQGLPTMARRNDDISELED LSELEDLKDAKLQTLKELFPQRSDNDLLKLIESTSTMDGAIAAALLMFGD AGGGPRKRKLSSSSEPYEEDEFNDDQSIKKTRLDHGEESNESAESSNNWE KQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQY ASQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFN QKRVVEDSEYDSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGE LTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQ ERDVVIRLMNKCEDISNKLTKQVTMLTGNGGGWNIEQPSILNQSLSLKPY QKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLI VVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVI VTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINAN NRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQ SIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQL YLGLFNRLKKSINNLVTEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLK EMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRHINNFQLDMD LILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYL RLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHD IDCNPYNDKQAEDRCHRVGQTKEALVIKLISQGTIEESMLKINQQKLKLE QDMTTVDEGDEGSMPADIATLLKTSMGL
    • Amino acids
      1 to 1028
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent helicase 1
    • ATP-dependent helicase 1
    • ETL1
    • hHEL1
    • Smarcad1
    • SMRCD_HUMAN
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
    see all
  • Function
    Probable ATP-dependent DNA helicase.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 2 CUE domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153429 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up