Recombinant Human SMARCD3 protein (ab152695)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPA GMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIR ELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISN TFNPAKPDAEDSDGSIASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELD KDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDYQPPQF KLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQ IFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDIDVE VEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFS RDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYF YCKIQQRRQELEQSLVVRNT
    • Amino acids
      1 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60 kDa BRG 1/Brm associated factor subunit C
    • 60 kDa BRG-1/Brm-associated factor subunit C
    • BAF60C
    • BRG1 associated factor 60C
    • BRG1-associated factor 60C
    • Chromatin remodeling complex BAF60C subunit
    • CRACD3
    • Mammalian chromatin remodeling complex BRG1 associated factor 60C
    • MGC111010
    • Rsc6p
    • Smarcd3
    • SMRD3_HUMAN
    • SWI/SNF complex 60 kDa subunit C
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily d member 3
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
    • Swp73 like protein
    see all
  • Function
    Plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. Stimulates nuclear receptor mediated transcription. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Tissue specificity
    Isoform 2 and isoform 1 are expressed in brain, heart, kidney, placenta, prostate, salivary gland, spleen, testis, thyroid, trachea and uterus. Isoform 1 is also expressed in skeletal muscle and adipose tissue.
  • Sequence similarities
    Belongs to the SMARCD family.
    Contains 1 SWIB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab152695 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up