Overview

  • Product name
    Recombinant Human SMC2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELK RRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAM EFVFGTTFVC
    • Amino acids
      521 to 630
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAP E
    • CAPE
    • Chromosome associated protein E
    • Chromosome-associated protein E
    • FLJ10093
    • hCAP E
    • hCAP-E
    • hCAPE
    • PRO0324
    • SMC 2
    • SMC protein 2
    • SMC-2
    • SMC2
    • SMC2 L1
    • SMC2_HUMAN
    • SMC2L1
    • Structural maintenance of chromosomes (SMC) family member chromosome associated protein E
    • Structural maintenance of chromosomes 2
    • Structural maintenance of chromosomes 2 like 1
    • Structural maintenance of chromosomes 2 yeast like 1
    • Structural maintenance of chromosomes protein 2
    • XCAP E homolog
    • XCAP-E homolog
    • XCAPE homolog
    see all
  • Function
    Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
  • Sequence similarities
    Belongs to the SMC family. SMC2 subfamily.
  • Domain
    The hinge domain, which separates the large intramolecular coiled coil regions, allows the heterodimerization with SMC4, forming a V-shaped heterodimer.
  • Cellular localization
    Nucleus. Cytoplasm. Chromosome. In interphase cells, the majority of the condensin complex is found in the cytoplasm, while a minority of the complex is associated with chromatin. A subpopulation of the complex however remains associated with chromosome foci in interphase cells. During mitosis, most of the condensin complex is associated with the chromatin. At the onset of prophase, the regulatory subunits of the complex are phosphorylated by CDC2, leading to condensin's association with chromosome arms and to chromosome condensation. Dissociation from chromosomes is observed in late telophase.
  • Information by UniProt

Images

  • ab153101 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up