Overview

  • Product name
    Recombinant Human SMC5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGGERSVSTMLYLMALQELNRCPFRVVDEINQGMDPINERRVFEMVVNTA CKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEPNTWNLKAFQRR RRRITFTQPS
    • Amino acids
      992 to 1101
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hSMC 5
    • hSMC5
    • KIAA0594
    • MLZ-453
    • OTTHUMP00000063367
    • SMC 5
    • SMC 5 structural maintenance of chromosomes 5 like 1
    • SMC protein 5
    • SMC5 L1
    • SMC5 protein
    • SMC5 structural maintenance of chromosomes 5 like 1
    • SMC5L1
    • Structural maintenance of chromosomes 5
    • Structural maintenance of chromosomes 5 like 1
    • Structural maintenance of chromosomes protein 5
    see all
  • Relevance
    Structural Maintenance of Chromosomes (SMC) family proteins play critical roles in various nuclear events that require structural changes of chromosomes, including mitotic chromosome organization, DNA recombination and repair and global transcriptional repression. The chromosome proteins are conserved in eukaryotes lead to mitotic chromosome segregation defects, suggesting a critical function of SMC family proteins in mitotic chromosome dynamics.
  • Cellular localization
    Nucleus. Chromosome. Chromosome; telomere. Note: Associates with chromatin. Localizes to PML nuclear bodies in ALT cell lines.

Images

  • ab161544 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161544 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up