Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQC CPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQ TQQQPHSPQNESRPSK
    • Amino acids
      1 to 116
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSMCSGEN1
    • MCS
    • MCSP
    • MCSP_HUMAN
    • Mitochondrial capsule selenoprotein
    • SMCP
    • Sperm mitochondria associated cysteine rich protein
    • Sperm mitochondrial-associated cysteine-rich protein
    see all
  • Function
    Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida.
  • Tissue specificity
    Testis. Is selectively expressed in the spermatids of seminiferous tubules.
  • Developmental stage
    Expressed in postmeiotic cells.
  • Cellular localization
    Cytoplasm. Mitochondrion membrane. Becomes associated with the spermatid mitochondrion capsule at step 16 of spermatogenesis.
  • Information by UniProt

Images

  • ab158868 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up