Overview

  • Product name
    Recombinant Human Smg1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKA VQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLA QLYEGWTAWV
    • Amino acids
      2922 to 3031
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 61E3.4
    • ATX
    • hSMG-1
    • hSMG1
    • KIAA0421
    • Lambda interacting protein
    • Lambda-interacting protein
    • Lambda/iota protein kinase C interacting protein
    • Lambda/iota protein kinase C-interacting protein
    • LIP
    • Phosphatidylinositol 3 kinase related kinase
    • Phosphatidylinositol 3 kinase related protein kinase
    • PI 3 kinase related kinase SMG 1
    • Serine/threonine protein kinase SMG1
    • Serine/threonine-protein kinase SMG1
    • SMG-1
    • smg1
    • SMG1_HUMAN
    see all
  • Function
    Serine/threonine protein kinase involved in both mRNA surveillance and genotoxic stress response pathways. Recognizes the substrate consensus sequence [ST]-Q. Plays a central role in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by phosphorylating UPF1/RENT1. Recruited by release factors to stalled ribosomes together with SMG8 and SMG9 (forming the SMG1C protein kinase complex), and UPF1 to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Also acts as a genotoxic stress-activated protein kinase that displays some functional overlap with ATM. Can phosphorylate p53/TP53 and is required for optimal p53/TP53 activation after cellular exposure to genotoxic stress. Its depletion leads to spontaneous DNA damage and increased sensitivity to ionizing radiation (IR). May activate PRKCI but not PRKCZ.
  • Tissue specificity
    Widely expressed, with highest level in heart and skeletal muscle. Expressed in placenta, brain, lung and spleen, but not in liver.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family.
    Contains 1 FAT domain.
    Contains 1 FATC domain.
    Contains 1 HEAT repeat.
    Contains 1 PI3K/PI4K domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab161516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up