Recombinant Human SMNDC1 protein (ab102020)

Overview

  • Product name
    Recombinant Human SMNDC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENE DLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCM AVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRK AKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKY NVRHLMPQ
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 238
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102020 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 30 kDa splicing factor SMNrp
    • MGC106917
    • MGC112663
    • SMN related protein
    • SMN-related protein
    • smndc1
    • SMNR
    • SPF30
    • SPF30_HUMAN
    • Splicing factor 30, survival of motor neuron-related
    • Survival motor neuron domain containing 1
    • Survival motor neuron domain containing protein 1
    • Survival motor neuron domain-containing protein 1
    • Survival of motor neuron related splicing factor 30
    • Survival of motor neuron-related-splicing factor 30
    see all
  • Function
    Necessary for spliceosome assembly. Overexpression causes apoptosis.
  • Tissue specificity
    Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas.
  • Sequence similarities
    Belongs to the SMN family.
    Contains 1 Tudor domain.
  • Cellular localization
    Nucleus speckle. Nucleus > Cajal body. Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab102020.

References

ab102020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up