Recombinant Human SMNDC1 protein (ab102020)

Overview

  • Product name
    Recombinant Human SMNDC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENE DLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCM AVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRK AKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKY NVRHLMPQ
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 238
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102020 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 30 kDa splicing factor SMNrp
    • MGC106917
    • MGC112663
    • SMN related protein
    • SMN-related protein
    • smndc1
    • SMNR
    • SPF30
    • SPF30_HUMAN
    • Splicing factor 30, survival of motor neuron-related
    • Survival motor neuron domain containing 1
    • Survival motor neuron domain containing protein 1
    • Survival motor neuron domain-containing protein 1
    • Survival of motor neuron related splicing factor 30
    • Survival of motor neuron-related-splicing factor 30
    see all
  • Function
    Necessary for spliceosome assembly. Overexpression causes apoptosis.
  • Tissue specificity
    Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas.
  • Sequence similarities
    Belongs to the SMN family.
    Contains 1 Tudor domain.
  • Cellular localization
    Nucleus speckle. Nucleus > Cajal body. Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies.
  • Information by UniProt

Recombinant Human SMNDC1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab102020.

References for Recombinant Human SMNDC1 protein (ab102020)

ab102020 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up