Recombinant Human Smoothened protein (ab112354)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99835
    • SpeciesHuman
    • SequenceGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGK LVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
    • Molecular weight37 kDa including tags
    • Amino acids56 to 155
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Frizzled family member 11
    • FZD11
    • Gx
    • Gx protein
    • Protein Gx
    • SMO
    • SMO_HUMAN
    • SMOH
    • Smoothened frizzled family receptor
    • Smoothened homolog
    • Smoothened homolog (Drosophila)
    • Smoothened homolog precursor (SMO) (Gx protein)
    • Smoothened seven transmembrane spanning receptor
    see all
  • FunctionG protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia.
  • Sequence similaritiesBelongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Smoothened protein images

  • ab112354 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Smoothened protein (ab112354)

ab112354 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"