Recombinant Human SMPDL3A protein (ab185389)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPVAPAGGRNPPPAIGQFWHVTDLHLDPTYHITDDHTKVCASSKGANASN PGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELST DTVINVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPVVTSKVYNAVA NLWKPWLDEEAISTLRKGGFYSQKVTTNPNLRIISLNTNLYYGPNIMTLN KTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYN EKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPV KSVLEKQTNNPGIRLFQYDPRDYKLLDMLQYYLNLTEANLKGESIWKLEY ILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTCDK TCKAFQICAIMNLDNISYADCLKQLYIKHNYVDHHHHHH
    • Molecular weight
      50 kDa including tags
    • Amino acids
      23 to 453
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Please see notes section.

  • Reconstitution
    Dissolve the lyophilized protein in 3X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. After reconstitution aliquot and store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Acid sphingomyelinase like phosphodiesterase 3a
    • Acid sphingomyelinase-like phosphodiesterase 3a
    • ASM like phosphodiesterase 3a
    • ASM-like phosphodiesterase 3a
    • ASM3A
    • ASM3A_HUMAN
    • ASML3A
    • FLJ20177
    • SMPDL3A
    • yR36GH4.1
    see all
  • Sequence similarities
    Belongs to the acid sphingomyelinase family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab185389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up