Overview

  • Product name
    Recombinant Human SMR3B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPP PPPYGPGRIPPPPPAPYGPGIFPPPPPQP
    • Amino acids
      1 to 79
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • P B
    • PBII
    • Peptide D1A
    • PRL3
    • PROL 3
    • PROL3
    • Proline rich 3
    • Proline rich peptide P B
    • Proline rich protein 3
    • Proline-rich peptide P-B
    • Proline-rich protein 3
    • salivary proline rich protein
    • SMR 1B
    • SMR 3B
    • SMR1B
    • SMR3B
    • SMR3B_HUMAN
    • submaxillary gland androgen regulated protein 3 homolog B
    • Submaxillary gland androgen regulated protein 3B
    see all
  • Tissue specificity
    Secreted into saliva by submaxillary gland. Not expressed in heart, brain, lung, liver, skeletal muscle, Kidney, pancreas or placenta.
  • Sequence similarities
    Belongs to the PROL1/PROL3 family.
  • Post-translational
    modifications
    P-A and D1A are probably degradation products of P-B.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161185 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up