Overview

  • Product name
    Recombinant Human SMRC2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLS SLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKF KSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEP KLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQ VLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNE WMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVP NVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENST GNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFF NGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRV HAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQ GRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKP TDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDD WNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQS GNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKV EEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEK KEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIV DPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAA AVKAKHFAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREA LEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGS QPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGST AGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSG HPGVADPGTPLPPDPTAPSPGTVTPVPPPQ
    • Molecular weight
      150 kDa including tags
    • Amino acids
      1 to 1130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BAF 170
    • BAF170
    • BRG1 associated factor 170
    • BRG1-associated factor 170
    • Chromatin remodeling complex BAF170 subunit
    • CRACC 2
    • CRACC2
    • Mammalian chromatin remodeling complex BRG1 associated factor 170
    • Rsc 8
    • Rsc8
    • SMARCC 2
    • Smarcc2
    • SMRC2_HUMAN
    • SWI/SNF complex 170 kDa subunit
    • SWI/SNF complex subunit SMARCC2
    • SWI/SNF related matrix associated actin dependent regulator of chromatin c2
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily c member 2
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2
    • SWI3 like protein
    see all
  • Function
    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Can stimulate the ATPase activity of the catalytic subunit of these complexes. May be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the SMARCC family.
    Contains 1 SANT domain.
    Contains 1 SWIRM domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116997 at approx. 150.30kDa.
    Stained with Coomassie Blue.

References

ab116997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up