Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVV FKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEI QDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCD PNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCF ECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMC QAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYR IFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHS LIEDLILLLEECDANIRAS
    • Amino acids
      1 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA74P14.1
    • bA74P14.1 (novel protein)
    • FLJ21080
    • histone lysine N methyltransferase SMYD3
    • KMT3E
    • MGC104324
    • SET and MYND domain containing 3
    • SET and MYND domain containing protein 3
    • SET and MYND domain-containing protein 3
    • SMYD 3
    • Smyd3
    • SMYD3 protein
    • SMYD3_HUMAN
    • Zinc finger MYND domain containing 1
    • Zinc finger MYND domain containing protein 1
    • Zinc finger MYND domain-containing protein 1
    • Zinc finger protein subfamily 3A MYND domain containing 1
    • Zinc finger protein, subfamily 3A (MYND domain containing), 1
    • ZMYND 1
    • ZMYND1
    • ZNFN3A1
    see all
  • Function
    Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but not monomethylation. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences.
  • Tissue specificity
    Expressed in skeletal muscles and testis. Overexpressed in a majority of colorectal and hepatocellular carcinomas.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family.
    Contains 1 MYND-type zinc finger.
    Contains 1 SET domain.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly cytoplasmic when cells are arrested at G0/G1. Accumulates in the nucleus at S phase and G2/M.
  • Information by UniProt

Images

  • ab153490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up