Recombinant Human SNAP25 Interacting Protein (ab164281)

Overview

  • Product name
    Recombinant Human SNAP25 Interacting Protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRVSEAARRQEDPLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQ RDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVE VEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRRQVDEGVWPPPNNLLSQS PKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGL DTPGKRSVDKAVSVEVLGPGIVGGAMSQVHTFLRPSFLEWGVPILWVFFL GGGGPVP
    • Amino acids
      1 to 257
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • p130Cas associated protein
    • p130Cas-associated protein
    • P140
    • p140Cap
    • SNAP-25-interacting protein
    • SNIP
    • SRC kinase signaling inhibitor 1
    • SRCIN1
    • SRCN1_HUMAN
    see all
  • Function
    Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance.
  • Tissue specificity
    Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue.
  • Sequence similarities
    Belongs to the SRCIN1 family.
  • Post-translational
    modifications
    Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Cell projection > axon. Cell projection > dendrite. Cell junction > synapse. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions.
  • Information by UniProt

Images

  • ab164281 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up