Recombinant Human SNAP29 protein (ab160441)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVL RRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQ DLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI STSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQ KIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKS TERKVRQL
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEDNIK
    • FLJ21051
    • SNAP 29
    • SNAP-29
    • SNAP29
    • SNP29_HUMAN
    • Soluble 29 kDa NSF attachment protein
    • Synaptosomal associated protein 29
    • Synaptosomal associated protein 29kDa
    • Synaptosomal-associated protein 29
    • Vesicle membrane fusion protein SNAP 29
    • Vesicle membrane fusion protein SNAP29
    • Vesicle-membrane fusion protein SNAP-29
    see all
  • Function
    Involved in multiple membrane trafficking steps.
  • Tissue specificity
    Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas.
  • Involvement in disease
    Defects in SNAP29 are the cause of CEDNIK syndrome (CEDNIK) [MIM:609528]. CEDNIK is a neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis and palmoplantar keratoderma.
  • Sequence similarities
    Belongs to the SNAP-25 family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization
    Cytoplasm. Membrane. Cell junction > synapse > synaptosome. Appears to be mostly membrane-bound, probably via interaction with syntaxins, but a significant portion is cytoplasmic.
  • Information by UniProt

Images

  • ab160441 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up