Recombinant Human SNAP43 protein (ab159551)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLE KNMFTKEALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVA LKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKK KIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSK PDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNS QETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQ VKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEE NESLSGTEFTASKKRRKH
    • Amino acids
      1 to 368
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Proximal sequence element-binding transcription factor subunit gamma
    • PSE binding factor subunit gamma
    • PSE-binding factor subunit gamma
    • PTF subunit gamma
    • PTFgamma
    • Small nuclear RNA activating complex polypeptide 1
    • small nuclear RNA activating complex, polypeptide 1, 43kDa
    • Small nuclear RNA-activating complex polypeptide 1
    • Small nuclear RNA-activating protein complex, 43-KD subunit
    • SNAP43
    • SNAPc 43 kDa subunit
    • SNAPc subunit 1
    • Snapc1
    • SNPC1_HUMAN
    • snRNA activating protein complex 43 kDa subunit
    • snRNA activating protein complex subunit 1
    • snRNA-activating protein complex 43 kDa subunit
    • snRNA-activating protein complex subunit 1
    see all
  • Function
    Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up