Recombinant Human SNAP45 protein (ab116890)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVF LQQLKGRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPL
    • Molecular weight
      37 kDa
    • Amino acids
      16 to 114

Specifications

Our Abpromise guarantee covers the use of ab116890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Proximal sequence element binding transcription factor delta subunit
    • Proximal sequence element binding transcription factor subunit delta
    • Proximal sequence element-binding transcription factor subunit delta
    • PSE binding factor delta subunit
    • PSE binding factor subunit delta
    • PSE-binding factor subunit delta
    • PTF delta subunit
    • PTF subunit delta
    • PTFdelta
    • Small nuclear RNA activating complex polypeptide 2
    • Small nuclear RNA-activating complex polypeptide 2
    • SNAP45
    • SNAPC 2
    • SNAPc 45 kDa subunit
    • SNAPc subunit 2
    • Snapc2
    • SNPC2_HUMAN
    • snRNA activating protein complex 2
    • snRNA activating protein complex 45 kDa subunit
    • snRNA activating protein complex subunit 2
    • snRNA-activating protein complex 45 kDa subunit
    • snRNA-activating protein complex subunit 2
    see all
  • Function
    Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116890 at approximately 36.52kDa stained with Coomassie Blue.

References

ab116890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up