Recombinant Human SNAPC4 protein (ab116993)

Overview

  • Product name
    Recombinant Human SNAPC4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLA EANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKD KVTGVGPPAN
    • Molecular weight
      38 kDa including tags
    • Amino acids
      53 to 162

Specifications

Our Abpromise guarantee covers the use of ab116993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ13451
    • OTTHUMP00000022583
    • Proximal sequence element binding transcription factor subunit alpha
    • Proximal sequence element-binding transcription factor subunit alpha
    • PSE binding factor subunit alpha
    • PSE-binding factor subunit alpha
    • PTF subunit alpha
    • PTFalpha
    • Small nuclear RNA activating complex polypeptide 4
    • Small nuclear RNA activating complex polypeptide 4 190kD
    • Small nuclear RNA activating complex polypeptide 4 190kDa
    • SNAP190
    • SNAPc 190 kDa subunit
    • SNAPc subunit 4
    • Snapc4
    • SNPC4_HUMAN
    • snRNA activating protein complex 190 kDa subunit
    • snRNA activating protein complex subunit 4
    • snRNA-activating protein complex 190 kDa subunit
    • snRNA-activating protein complex subunit 4
    see all
  • Function
    Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
  • Sequence similarities
    Contains 3 HTH myb-type DNA-binding domains.
    Contains 2 Myb-like domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116993 at approximately 37.84kDa.
    Stained with Coomassie Blue.

References

ab116993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up