Recombinant Human SNAPC4 protein (ab116993)

Overview

  • Product nameRecombinant Human SNAPC4 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ5SXM2
    • SpeciesHuman
    • SequencePADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLA EANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKD KVTGVGPPAN
    • Molecular weight38 kDa including tags
    • Amino acids53 to 162

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ13451
    • OTTHUMP00000022583
    • Proximal sequence element binding transcription factor subunit alpha
    • Proximal sequence element-binding transcription factor subunit alpha
    • PSE binding factor subunit alpha
    • PSE-binding factor subunit alpha
    • PTF subunit alpha
    • PTFalpha
    • Small nuclear RNA activating complex polypeptide 4
    • Small nuclear RNA activating complex polypeptide 4 190kD
    • Small nuclear RNA activating complex polypeptide 4 190kDa
    • SNAP190
    • SNAPc 190 kDa subunit
    • SNAPc subunit 4
    • Snapc4
    • SNPC4_HUMAN
    • snRNA activating protein complex 190 kDa subunit
    • snRNA activating protein complex subunit 4
    • snRNA-activating protein complex 190 kDa subunit
    • snRNA-activating protein complex subunit 4
    see all
  • FunctionPart of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
  • Sequence similaritiesContains 3 HTH myb-type DNA-binding domains.
    Contains 2 Myb-like domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNAPC4 protein images

  • 12.5% SDS-PAGE showing ab116993 at approximately 37.84kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SNAPC4 protein (ab116993)

ab116993 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"