Overview

  • Product name
    Recombinant Human SNF2H protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQP AAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
    • Molecular weight
      36 kDa including tags
    • Amino acids
      59 to 147

Specifications

Our Abpromise guarantee covers the use of ab152876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4933427E24Rik
    • D030040M08Rik
    • D330027N15Rik
    • EC 3.6.1.-
    • hISWI
    • hSNF2H
    • ISWI
    • MommeD4
    • SMARCA5
    • SMCA5_HUMAN
    • Snf2h
    • Sucrose nonfermenting like 5
    • Sucrose nonfermenting protein 2 homolog
    • Sucrose nonfermenting, yeast, homolog of
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
    • WCRF135
    see all
  • Function
    Helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity. Complexes containing SMARCA5 are capable of forming ordered nucleosome arrays on chromatin; this may require intact histone H4 tails. Also required for replication of pericentric heterochromatin in S-phase specifically in conjunction with BAZ1A. Probably plays a role in repression of polI dependent transcription of the rDNA locus, through the recruitment of the SIN3/HDAC1 corepressor complex to the rDNA promoter. Essential component of the WICH complex, a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH complex regulates the transcription of various genes, has a role in RNA polymerase I and RNA polymerase III transcription, mediates the histone H2AX phosphorylation at 'Tyr-142', and is involved in the maintenance of chromatin structures during DNA replication processes. Essential component of the NoRC (nucleolar remodeling complex) complex, a complex that mediates silencing of a fraction of rDNA by recruiting histone-modifying enzymes and DNA methyltransferases, leading to heterochromatin formation and transcriptional silencing.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family. ISWI subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 2 SANT domains.
  • Developmental stage
    Overexpressed in CD34-positive erythrocyte progenitor cells in acute myeloid leukemia. Down-regulation correlates with hematologic remission following chemotherapy.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152876 stained with Coomassie Blue.

References

ab152876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up