Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPD APCIQCLECCGMFAPQTFVMHSHRSPDK
    • Molecular weight
      34 kDa including tags
    • Amino acids
      236 to 313

Specifications

Our Abpromise guarantee covers the use of ab114510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000213557
    • OTTHUMP00000213591
    • OTTHUMP00000213592
    • OTTHUMP00000213595
    • SKI like
    • SKI like oncogene
    • Ski like protein
    • SKI like proto oncogene
    • Ski related oncogene
    • Ski related oncogene snoN
    • Ski related protein
    • Ski-like protein
    • Ski-related oncogene
    • Ski-related protein
    • SKIL
    • SKIL_HUMAN
    • SNO
    • SnoA
    • SnoI
    • SnoN
    see all
  • Function
    May have regulatory role in cell division or differentiation in response to extracellular signals.
  • Tissue specificity
    Isoform SNON and isoform SNOA are widely expressed. Highest expression is found in skeletal muscle, followed by placenta and lung. Lowest expression in heart, brain and pancreas. Isoform SNOI expression is restricted to skeletal muscle.
  • Sequence similarities
    Belongs to the SKI family.
  • Information by UniProt

Images

  • ab114510 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up